General Information

  • ID:  hor003413
  • Uniprot ID:  B3TZ52
  • Protein name:  Orcokinin
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  FDAFTTGFGHN
  • Length:  11
  • Propeptide:  MTGEVFSVVLLLTLSVFAAAGPIKVRFLSAIFIPIAAPARSSPQQDAAAGYTDGAPVKRFDAFTTGFGHNKRSSEDMDRLGFGFNKRNFDEIDRSGFGFHKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFNKRNFDEIDRSGFGFHKRGDYDVYPEKRNFDEIDRSGFGFVKRVYGPRDIANLYKRNFDEIDRSGFGFVRRSAE
  • Signal peptide:  MTGEVFSVVLLLTLSVFAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B3TZ52-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003413_AF2.pdbhor003413_ESM.pdb

Physical Information

Mass: 139182 Formula: C56H72N14O17
Absent amino acids: CEIKLMPQRSVWY Common amino acids: F
pI: 5.29 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -20 Boman Index: -1253
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 9.09
Instability Index: 3411.82 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  22860213
  • Title:  Mass Spectral Charting of Neuropeptidomic Expression in the Stomatogastric Ganglion at Multiple Developmental Stages of the Lobster Homarus Americanus